209837327
Menu
Your Cart
UK Based - We ship to the EU, the USA, Australia, New Zealand - in fact we ship WORLDWIDE! Please see our FAQ/Terms for specifics if needed. NEW DEDICATED CUSTOMER SERVICE EMAIL: customerservice@peptex-labs.com

IGF1-DES 1mg

IGF1-DES 1mg
Hot
IGF1-DES 1mg
  • Stock: In Stock
  • Model: IGF1-DES 1mg
15102 samples sold
18262 views
£40.00

IGF1-DES 1mg

IGF-1 DES is a naturally occurringendogenous protein, as well as drug, and truncated analogue of insulin-like growth factor 1 (IGF-1) des IGF-1 lacks the first three amino acids at the N-terminus of IGF-1 (for a total of 67 amino acids, relative to the 70 of IGF-1). As a result of this difference, it has considerably reduced binding to the Insulin-like growth factor-binding proteins (IGFBPs) and enhanced potency (about 10-fold in vivo) relative to IGF-1.

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 7,372 Da
Synonyms: IGF-1 Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)

IGF1-DES is available for research needs. It is not accessible for human use and continues to be a popular research chemical. It should ideally be handled by professionals who are aware f the safety concerns and benefits that the product provides for research purposes.

Lyophilized peptides although stable at room temperature for 3 months, should be stored dessicated below -18 degrees Celsius. Upon reconstitution of the peptide it should be stored at 4 degrees Celsius between 2-21 days and for future use below -18 degrees Celsius.


Peptex Laboratories Products are sold strictly for research purposes only. Please do not ask about human consumption as this is strictly forbidden.

&am

Write a review

Note: HTML is not translated!
Bad Good

Unlimited Blocks, Tabs or Accordions with any HTML content can be assigned to any individual product or to certain groups of products, like entire categories, brands, products with specific options, attributes, price range, etc. You can indicate any criteria via the advanced product assignment mechanism and only those products matching your criteria will display the modules.

Also, any module can be selectively activated per device (desktop/tablet/phone), customer login status and other criteria. Imagine the possibilities. 

Your data & cookies
Your Privacy: Peptex-Labs.com use cookies by default through it’s shopping cart - while we use cookies we do not do so for any other reason than our base shopping cart software utilises cookies by default (Opencart.com). Should you require further info please contact us at peptexlabs@protonmail.com