209837327
Menu
Your Cart
UK Based - We ship to the EU, the USA, Australia, New Zealand - in fact we ship WORLDWIDE! Please see our FAQ/Terms for specifics if needed. NEW DEDICATED CUSTOMER SERVICE EMAIL: customerservice@peptex-labs.com

IGF1-LR3 1mg

IGF1-LR3 1mg
Hot
IGF1-LR3 1mg
  • Stock: In Stock
  • Model: IGF1-LR3 1mg
15289 samples sold
18443 views
£40.00

IGF1-LR3 1mg


Long arginine 3-IGF-1, abbreviated as IGF-1 LR3 or LR3-IGF-1, is a synthetic protein and lengthened analogue of human insulin-like growth factor 1 (IGF-1). It differs from native IGF-1 in that it possesses an arginine instead of a glutamic acid at the third position in its amino acid sequence ("arginine 3"), and also has an additional 13 amino acids at its N-terminus (MFPAMPLLSLFVN) ("long"), for a total of 83 amino acids (relative to the 70 of IGF-1). The consequences of these modifications are that IGF-1 LR3 retains the pharmacological activity of IGF-1 as an agonist of the IGF-1 receptor, has very low affinity for the Insulin-like growth factor-binding proteins (IGFBPs), and has improved metabolic stability. As a result, it is approximately three times more potent than IGF-1, and possesses a significantly longer half-life of about 20–30 hours (relative to IGF-1's half-life of about 12–15 hours).

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

IGF1-LR3 is available for research needs. It is not accessible for human use and continues to be a popular research chemical. It should ideally be handled by professionals who are aware f the safety concerns and benefits that the product provides for research purposes.

Lyophilized peptides although stable at room temperature for 3 months, should be stored dessicated below -18 degrees Celsius. Upon reconstitution of the peptide it should be stored at 4 degrees Celsius between 2-21 days and for future use below -18 degrees Celsius.


Peptex Laboratories Products are sold strictly for research purposes only. Please do not ask about human consumption as this is strictly forbidden.

Write a review

Note: HTML is not translated!
Bad Good

Unlimited Blocks, Tabs or Accordions with any HTML content can be assigned to any individual product or to certain groups of products, like entire categories, brands, products with specific options, attributes, price range, etc. You can indicate any criteria via the advanced product assignment mechanism and only those products matching your criteria will display the modules.

Also, any module can be selectively activated per device (desktop/tablet/phone), customer login status and other criteria. Imagine the possibilities. 

Your data & cookies
Your Privacy: Peptex-Labs.com use cookies by default through it’s shopping cart - while we use cookies we do not do so for any other reason than our base shopping cart software utilises cookies by default (Opencart.com). Should you require further info please contact us at peptexlabs@protonmail.com