ACTH 1-39 peptide
Please be advised that this product will come labelled as Peptide Special Edition as we only stock this product in small quantities, however it will be sent with data sheet and a label on the outer packaging to verify content, thank you.
|
Name |
ACTH 1-39 |
|
Sequence |
SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
|
3-letter-code |
Ser - Tyr - Ser - Met - Glu - His - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - Phe |
|
Molecular weight |
4541.13 |
|
Counter ion |
TFA |
|
Solubilization |