IGF1-LR3 1mg

£40.00

  • Product Code: IGF1-LR3 1mg
  • Availability: In Stock
  • Ex Tax: £40.00

IGF1-LR3 1mg


Long arginine 3-IGF-1, abbreviated as IGF-1 LR3 or LR3-IGF-1, is a synthetic protein and lengthened analogue of human insulin-like growth factor 1 (IGF-1). It differs from native IGF-1 in that it possesses an arginine instead of a glutamic acid at the third position in its amino acid sequence ("arginine 3"), and also has an additional 13 amino acids at its N-terminus (MFPAMPLLSLFVN) ("long"), for a total of 83 amino acids (relative to the 70 of IGF-1). The consequences of these modifications are that IGF-1 LR3 retains the pharmacological activity of IGF-1 as an agonist of the IGF-1 receptor, has very low affinity for the Insulin-like growth factor-binding proteins (IGFBPs), and has improved metabolic stability. As a result, it is approximately three times more potent than IGF-1, and possesses a significantly longer half-life of about 20–30 hours (relative to IGF-1's half-life of about 12–15 hours).

Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA
Molar Mass: 9,111 Da
Synonyms:Long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1

IGF1-LR3 is available for research needs. It is not accessible for human use and continues to be a popular research chemical. It should ideally be handled by professionals who are aware f the safety concerns and benefits that the product provides for research purposes.

Lyophilized peptides although stable at room temperature for 3 months, should be stored dessicated below -18 degrees Celsius. Upon reconstitution of the peptide it should be stored at 4 degrees Celsius between 2-21 days and for future use below -18 degrees Celsius.


Peptex Laboratories Products are sold strictly for research purposes only. Please do not ask about human consumption as this is strictly forbidden.

Write a review

Note: HTML is not translated!
    Bad           Good