Menu
Your Cart
*AMAZON ORDER CUSTOMERS SEE NOTICE BELOW* 50% OFF USING COUPON CODE JULY50 - EXPIRES 23RD JULY 21. NEW EMAIL: peptexlabs@protonmail.com for any and all queries. PLEASE SEE NOTICE FURTHER NEWS NOTICES FURTHER DOWN THE HOME PAGE, THANK YOU.

Peptides - Single Units

We offer our peptide range in both single and varying multi packs. Please click or hover over the home page Peptide menu button and click the drop down box you want to view, e.g., 1 unit, 4 units, 10 units.

Model: CAVA
Small amount of trial stocks remaining. Limited stock available, we do not usually stock this peptide but we had custom synthesised a batch for a good client and had some additional remaining from our minimum order requirements. This item will come labelled as 'Special Edition Peptide' alo..
£55.00
Ex Tax:£55.00
Model: PEG-MGF 5mg
New as of September 2020, our Peg MGF is now sold in 5mg form, as opposed to the 2mg we had stocked the last 3 years. This is due to customer request, this peptide is very popular and as such by more than doubling the dosage and raising the price by 20% we feel this product offers excellent value.PE..
£29.00
Ex Tax:£29.00
Model: BAC10
Peptex Laboratories 10 pack Bacteriostatic Water 0.9% - 10 vials x 10mL - 100mL total..
£45.00
Ex Tax:£45.00
Model: AA2ML
For those who do not need voluminous quantities of Acetic Acid, we now offer this product in a 5 pack of 2ml vials, each with butyl stopper and flip off lid.Note the image displayed is for illustrative purposes only - the vials and labels are of identical style, hence the reason for using the image ..
£10.00
Ex Tax:£10.00
Model: TB5+BP5+BW
BACK IN STOCK!5 Package combo containing;TB-500 5mg x 2 vialsBPC-157 5mg x 2 vialsBacteriostatic Water x 10ml..
£72.50
Ex Tax:£72.50
Model: BW5
Peptex Laboratories 5 Pack Bacteriostatic Water x 10mL - 50mL total volume..
£24.50
Ex Tax:£24.50
Model: ACVR2B 10mg
ACVR2B 10mg – ACE-031 10mgSynonyms: Activin Receptor Type-2B, Activin Receptor Type IIB, ACTR-IIB, ACE-031Sequence:GNCWLRQAKN GRCQVLYKTE LSKEECCSTG RLSTSWTEED VNDNTLFKWM IFNGGAPNCI PCKETCENVD CGPGKKCRMN KKNKPRCVCA PDCSNITWKG PVCGLDGKTY RNECALLKAR CKEQPELEVQ YQGRCKKTCR DVFCPGSSTC VVDQTNNAYC VTCNRICPE..
£42.50
Ex Tax:£42.50
Model: ACE-031 1mg
ACE-031 1mgACE-031 is an engineered decoy receptor used in attempts to treat children with Duchenne Muscular Dystrophy (DMD). The ACE-031 receptor circulates outside the muscle-fibre membrane. Because this receptor binds to myostatin, it lowers the amount of myostatin that can bind..
£27.50
Ex Tax:£27.50
Model: Peptex Laboratories Acetic Acid 0.6% 10ml Vial
Dilutent - in particular for diluent use of IGF1 Lr3/IGF2/IGF3 and DES variants.0.6% Acetic Acid mixed with sterile distilled water, and double filtered via a .22 nylon and then PVDF membrane filter...
£6.50
Ex Tax:£6.50
Model: ACTH 1-39 10mg
Peptex Laboratories ACTH 1-39 PeptideName: ACTH 1-39 - Adrenocorticotropic HormoneSequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEFMolecular Weight: 4541.13Counter Ion: TFAAdrenocorticotropic hormone (ACTH), also known as corticotropin, is produced and secreted by the anterior pituitary gland. ..
£25.00
Ex Tax:£25.00
Model: Peptex Labs Adipotide/Vit D3
We are pleased to introduce our newly synthesised peptide, Adipotide 10mg and Vitamin D3 2mg (12mg total) designed to compliment each others unique action.This product is a current limited edition, dependant on customer demand. As such this product will come with Limited/Special Edition Label with s..
£40.00
Ex Tax:£40.00
Model: FTTP Adipotide
 Sequence: CKGGRAKDC-GG-D(KLAKLAK)2Molar Mass: 2555.22 g/molMolecular Formula: C111H204N36O28S2Peptide Sequence: H-Cys-Lys-Gly-Gly-Arg-Ala-Lys-Asp-Cys-Gly-Gly-Asp-(Lys-Leu-Ala-Lys-Leu-Ala-Lys)2CID: 439302 Adipotode 5mg – General Overview: Aditpotide is an expe..
£30.00
Ex Tax:£30.00
Showing 13 to 24 of 98 (9 Pages)
Your data & cookies
Your Privacy: Peptex-Labs.com use cookies by default through it’s shopping cart - while we use cookies we do not do so for any other reason than our base software utilises cookies by default. Should you require further info please contact us at peptexlabs@protonmail.com