ACTH 1-39 10mg

£25.00

  • Product Code: ACTH 1-39 10mg
  • Availability: In Stock
  • Ex Tax: £25.00


ACTH 1-39 peptide

Please be advised that this product will come labelled as Peptide Special Edition as we only stock this product in small quantities, however it will be sent with data sheet and a label on the outer packaging to verify content, thank you.

Name

ACTH 1-39

Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

3-letter-code

Ser - Tyr - Ser - Met - Glu - His - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - Phe

Molecular weight

4541.13

Counter ion

TFA

Solubilization

Write a review

Note: HTML is not translated!
    Bad           Good