IGF1-DES 1mg
IGF-1 DES is a naturally occurring, endogenous protein, as well as drug, and truncated analogue of insulin-like growth factor 1 (IGF-1) des IGF-1 lacks the first three amino acids at the N-terminus of IGF-1 (for a total of 67 amino acids, relative to the 70 of IGF-1). As a result of this difference, it has considerably reduced binding to the Insulin-like growth factor-binding proteins (IGFBPs) and enhanced potency (about 10-fold in vivo) relative to IGF-1.
Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Molar
Mass: 7,372 Da
Synonyms: IGF-1
Des(1-3), Des1-3, Des 1-3, Des (1-3), IGF-1 (4-70)
IGF1-DES is available for research needs. It is not accessible for human use and continues to be a popular research chemical. It should ideally be handled by professionals who are aware f the safety concerns and benefits that the product provides for research purposes.
Lyophilized peptides although stable at room temperature for 3 months, should be stored dessicated below -18 degrees Celsius. Upon reconstitution of the peptide it should be stored at 4 degrees Celsius between 2-21 days and for future use below -18 degrees Celsius.
Peptex Laboratories Products
are sold strictly for research purposes only. Please do not ask about human
consumption as this is strictly forbidden.
&am