Product Code: ACTH 1-39 10mg
Availability: In Stock
£25.00
Ex Tax: £25.00

Follow us on Instagram!

After many account deletions, we clicked as to why we had been deleted and we have a new account - @peptexwade19 - we will post pictures of new peptide and sarm developments but will not promote or sell on this platform. We aim to educate and inspire. 

PRE ORDER AVAILABLE - PLEASE BE ADVISED A WAIT TIME OF 4-8 DAYS FROM PAYMENT TO DISPATCH. IF YOU CANNOT WAIT THIS PERIOD PLEASE DO NOT ORDER.


ACTH 1-39 peptide

Please be advised that this product will come labelled as Peptide Special Edition as we only stock this product in small quantities, however it will be sent with data sheet and a label on the outer packaging to verify content, thank you.

Name

ACTH 1-39

Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

3-letter-code

Ser - Tyr - Ser - Met - Glu - His - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - Phe

Molecular weight

4541.13

Counter ion

TFA

Solubilization

Write a review

Please login or register to review