Product Code: ACTH 1-39 10mg
Availability: In Stock
£25.00
Ex Tax: £25.00

Follow us on Instagram!

We may not post there often but follow us at @wadepeptex and we will do our best to start ramping up the content in a way that is in line with IG's strict guidelines :)

Did you know we accept Amazon Pay and also payment by phone and offline through our virtual payment terminal. Either call us on 01494 936684 or if outside of business hours please use the offline card form, which is sent to us with the highest levels of security - once processed your private information pertaining to the payment is deleted, only an invoice is left online.



ACTH 1-39 peptide

Please be advised that this product will come labelled as Peptide Special Edition as we only stock this product in small quantities, however it will be sent with data sheet and a label on the outer packaging to verify content, thank you.

Name

ACTH 1-39

Sequence

SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF

3-letter-code

Ser - Tyr - Ser - Met - Glu - His - Phe - Arg - Trp - Gly - Lys - Pro - Val - Gly - Lys - Lys - Arg - Arg - Pro - Val - Lys - Val - Tyr - Pro - Asn - Gly - Ala - Glu - Asp - Glu - Ser - Ala - Glu - Ala - Phe - Pro - Leu - Glu - Phe

Molecular weight

4541.13

Counter ion

TFA

Solubilization

Write a review

Note: HTML is not translated!
Captcha